PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 348aa    MW: 38853.3 Da    PI: 6.5174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616333.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
   XP_013616333.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.69e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_013616333.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.782965IPR017930Myb domain
SuperFamilySSF466891.58E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001673.46E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007177.7E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.41266116IPR017930Myb domain
PfamPF002494.8E-1467112IPR001005SANT/Myb domain
CDDcd001673.67E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRPPCCEKT GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
QSGEEDNDDF SSSNTISKKQ HQSSNKGQWE RRLQTDINMA KQALSEALSL DKKPSSSPSL  180
STPITPQNIP SFTSVLLDRF HDPSSSSSST TTTTTTTTTN ATNLYTAGVY ASSAENIARL  240
LQDFMKDTPK PLTLTSSSPV SETGPLASAA SEEGGQGFEQ SFFSFNSMEE TQNLTQETNF  300
FHNQESKPAI TMDHDFGLIS QGPLSLLEKW LFDENMVGMS LEGQEAIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261411627128MYB TRANSFORMING PROTEIN
1mse_C7e-26141164105C-Myb DNA-Binding Domain
1msf_C7e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756610.0KM975661.1 Brassica napus MYB transcription factor 96-1.1 (MYB96-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616333.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU71e-110MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D3AYD50.0A0A0D3AYD5_BRAOL; Uncharacterized protein
STRINGBra029258.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-180myb domain protein 96